Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q9CR48

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTIPPERCLFGVML NIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSTLFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVNNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND1 Human Gene Knockout Kit (CRISPR)
KN424679 1 Kit

ZFAND1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF647 conjugate, 0.1mg/mL
BNC472324-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USP8 (NM_001128610) Human Over-expression Lysate
LY426972 100 µg

USP8 (NM_001128610) Human Over-expression Lysate

Sign In for Pricing
View Details
Propylene Glycol 2-Beta-Glucopyranosiduronic Acid Benzyl Ester-d6
TRC-P835263-5MG 5 mg

Propylene Glycol 2-Beta-Glucopyranosiduronic Acid Benzyl Ester-d6

Sign In for Pricing
View Details
Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit
RDR-NFATC2-Hu-01 96 Tests

Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit
RDR-NFATC2-Hu-02 48 Tests

Human Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) ELISA Kit

Sign In for Pricing
View Details