Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q9CR48

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTIPPERCLFGVML NIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSTLFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVNNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nogo B receptor (NUS1) activation kit by CRISPRa
GA114569 1 Kit

Human Nogo B receptor (NUS1) activation kit by CRISPRa

Sign In for Pricing
View Details
DOK1 Rabbit Polyclonal Antibody
AP02767PU-N 100 µL

DOK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF216 Antibody
KC-29173-01 50 μL

RNF216 Antibody

Sign In for Pricing
View Details
RNF216 Antibody
KC-29173-02 100 µL

RNF216 Antibody

Sign In for Pricing
View Details
RNF216 Antibody
KC-29173-03 1 mL

RNF216 Antibody

Sign In for Pricing
View Details
PRKAR1B (NM_001164762) Human Over-expression Lysate
LC431890 20 µg

PRKAR1B (NM_001164762) Human Over-expression Lysate

Sign In for Pricing
View Details