Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q9CR48

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTIPPERCLFGVML NIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSTLFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVNNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Peptide Peptidase (HM13) (NM_178581) Human Over-expression Lysate
LC403610 20 µg

Signal Peptide Peptidase (HM13) (NM_178581) Human Over-expression Lysate

Sign In for Pricing
View Details
ACVR2B Mouse Monoclonal Antibody [A5H6]
HA600066 100 µL

ACVR2B Mouse Monoclonal Antibody [A5H6]

Sign In for Pricing
View Details
MIR6510 Human qPCR Primer Pair (MI0022222)
HP301299 200 Reactions

MIR6510 Human qPCR Primer Pair (MI0022222)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB533268 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
ARHGAP1 Antibody
KC-2313-01 50 μL

ARHGAP1 Antibody

Sign In for Pricing
View Details
ARHGAP1 Antibody
KC-2313-02 100 µL

ARHGAP1 Antibody

Sign In for Pricing
View Details