Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Roseiflexus sp. Cobalamin synthase (cobS)

This Recombinant Roseiflexus sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5V212

Expression Region

1-268

Origin

Roseiflexus sp. (strain RS-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEDTTSQRAPRNWWGPFAPIGEALRFLTILPVPGLPPMSEEAIPQSIRYFPIAGLVIG GILAAVGWGAGVLWNETVRAVVLVVAWGVLTAGMHLDGLSDTFDGVMSWRSRERKLEIMR DSRIGVMGALALAAVLGLKAAFLAGAGDAWLTAVVLAPVLGRWADVYGIVRFPPAREGGL GRTFQSYLRPGDFAGASVATLALALIVGGVGGLIALALVWMVTHLLGRWWTRDLGGLTGD TYGALCEIAEVVALATLTLSAPMRLLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D24 (B-4) Alexa Fluor® 790
sc-515806 AF790 200 µg/mL

TBC1D24 (B-4) Alexa Fluor® 790

Sign In for Pricing
View Details
RPS16 Antibody
orb1243550 100 µL

RPS16 Antibody

Sign In for Pricing
View Details
CCT5 polyclonal antibody
BS8532-01 50 µL

CCT5 polyclonal antibody

Sign In for Pricing
View Details
CCT5 polyclonal antibody
BS8532-02 100 µL

CCT5 polyclonal antibody

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 750) discontinued
C2277-06Q1-ML750 100 µL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MIR526A1 Human MicroRNA Expression Plasmid (MI0003157)
SC400487 10 µg

MIR526A1 Human MicroRNA Expression Plasmid (MI0003157)

Sign In for Pricing
View Details