Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermanaerovibrio acidaminovorans Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Thermanaerovibrio acidaminovorans Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D1B5U2

Expression Region

1-269

Origin

Thermanaerovibrio acidaminovorans (strain ATCC 49978 / DSM 6589 / Su883) (Selenomonas acidaminovorans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSISEKVTLGQYVPADSPVHSLDPRTKILSTLVLLFALFGVRDPRFFLGWGVLLAFIVFL SRVSLRTVLRSVRPVLWLLVFTVLLHALFTPGEAILRFHFIKVSREGLHMAALMGVRLVL LVAFAGLLTLTTSPMELADGMESLMSPLARVRFPAHEMAMMMTIALRFIPTLLEETDRIL KAQISRGADLEGGGVVKRLRAFVPVLVPLFLIVFQRAEDLALAMESRCYVGGVGRTRMRP LRWCLEDWVALGLMSVSVAGLLFLERAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF594 conjugate, 0.1mg/mL
BNC940904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL
BNC680901-500 1x 500 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL
BNC680685-100 1x 100 µL

CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details