Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Surfeit locus protein 4 (SURF4)

This Recombinant Chicken Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q800K9

Expression Region

1-269

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDIMSTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDGTWN CGYFLASIFVFINLFGQLSGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDMNFF YILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINIYFNAFWTIPAYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL
BNC473177-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nephronophthisis (NPHP1) Human Gene Knockout Kit (CRISPR)
KN422151 1 Kit

Nephronophthisis (NPHP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fellutamide B (Mixture of Diastereomers, >80%)
TRC-F138000-5MG 5 mg

Fellutamide B (Mixture of Diastereomers, >80%)

Sign In for Pricing
View Details
PRAMEF14 Human Gene Knockout Kit (CRISPR)
KN417489 1 Kit

PRAMEF14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS640758 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
EZH2 / KMT6 (EZH2/2536), CF647 conjugate, 0.1mg/mL
BNC472536-500 1x 500 µL

EZH2 / KMT6 (EZH2/2536), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details