Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Surfeit locus protein 4 (SURF4)

This Recombinant Chicken Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q800K9

Expression Region

1-269

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDIMSTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDGTWN CGYFLASIFVFINLFGQLSGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDMNFF YILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINIYFNAFWTIPAYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin A3 (EFNA3) Mouse Monoclonal Antibody [Clone ID: OTI4A4]
CF806050 100 µg

Ephrin A3 (EFNA3) Mouse Monoclonal Antibody [Clone ID: OTI4A4]

Sign In for Pricing
View Details
Cdh12 Mouse Gene Knockout Kit (CRISPR)
KN503001 1 Kit

Cdh12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS713041 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Human IL-4 Antibody Pair Set
E-KAB-0402 50 µL & 100 µg

Human IL-4 Antibody Pair Set

Sign In for Pricing
View Details
Haze Meter BMET-1201
BMET-1201 1 Unit

Haze Meter BMET-1201

Sign In for Pricing
View Details
D-Galactal
TRC-G151000-5G 5 g

D-Galactal

Sign In for Pricing
View Details