Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus radiodurans Cobalamin synthase (cobS)

This Recombinant Deinococcus radiodurans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9RYR9

Expression Region

1-269

Origin

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQPSPAPVVTITPAPAPAAPSHPHGWKRKQEFKALHLALAFLTTLPLPHVRDVQPGDFA RASAYYPLAGYAVGGLVAGLLYLNVPLPPGVVAALGVGLWLGLTGMLHFDGLVDSADALF AMKSPEQRLDILKDVHVGAFGLATGVLALLLLWSLLGAGLPWYAPLVAAVVARMVVLMPM NAYPAARQESLGAQSRQGRWGLAFLFALPALLLPHAWLAALVALLGVTLVAAWAARRLGG GLSGDVYGLLIVVAELLVLGFYGWGFTPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl17 Rabbit Polyclonal Antibody (HRP)
orb2103974 100 µL

Rpl17 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
N1, N2-Bis[2- (diethylamino) ethyl]ethanediamide
460263-01 100 mg

N1, N2-Bis[2- (diethylamino) ethyl]ethanediamide

Sign In for Pricing
View Details
N1, N2-Bis[2- (diethylamino) ethyl]ethanediamide
460263-02 250 mg

N1, N2-Bis[2- (diethylamino) ethyl]ethanediamide

Sign In for Pricing
View Details
NODAL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31977111 3x 1.0 µg

NODAL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GCET2 Protein Vector (Mouse) (pPB-N-His)
PV181491 500 ng

GCET2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Voltage-gated potassium channel subunit beta-3, KCNAB3 ELISA Kit
MBS9320789-01 48 Well

Mouse Voltage-gated potassium channel subunit beta-3, KCNAB3 ELISA Kit

Sign In for Pricing
View Details