Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Type 4 prepilin-like proteins leader peptide-processing enzyme (hofD)

This Recombinant Synechocystis sp. Type 4 prepilin-like proteins leader peptide-processing enzyme (hofD) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P72640

Expression Region

1-269

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLIAPLAFLLAIALGCAVGSFLNVVAYRLPEGLSLVHPPSRCPHCGHRLGPKENVPVV GWLWLRGKCRWCQTAISPRYPLVEAATGFLFALTCWRFGWQWQTFGYWILISFLISLTLI DWDTMTLPNSLTKPGLVLGLLFHLLLGWQRGHWIVPLVEAIASAVLGLWLFDLIRMGGSL LLGREGMGDGDPKLASMVGAWLGWPSLLLTTFIACFIGSIYGGLKLLLGTLQRRQGFPFG PFLAIGALISLFWGEKLITSYLNFVTPQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSGIN1 Rabbit Polyclonal Antibody (PE)
orb2588796 100 µg

OSGIN1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CAD Antibody
ABD7658 100 µg

CAD Antibody

Sign In for Pricing
View Details
COL8A1 Protein Vector (Rat) (pPM-C-HA)
16598026 500 ng

COL8A1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RXRA, ID (RXRA, NR2B1, Retinoic acid receptor RXR-alpha, Nuclear receptor subfamily 2 group B member 1, Retinoid X receptor alpha) (APC) discontinued
041347-APC 200 µL

RXRA, ID (RXRA, NR2B1, Retinoic acid receptor RXR-alpha, Nuclear receptor subfamily 2 group B member 1, Retinoid X receptor alpha) (APC) discontinued

Sign In for Pricing
View Details
Trp53rk Protein Vector (Mouse) (pPB-C-His)
PV241946 500 ng

Trp53rk Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human ACY3 Protein (C-His)
32-10974-500 500 µg

Recombinant Human ACY3 Protein (C-His)

Sign In for Pricing
View Details