Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Probable nitrite transporter (nirC)

This Recombinant Salmonella typhimurium Probable nitrite transporter (nirC) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Probable nitrite transporter

UniProt

P25926

Expression Region

1-269

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV MGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTISHGQMWAILPQTWLGNLVGSVFVA LLYSWGGGSLLPVDTSIVHSVALAKTTAPATVLFFKGALCNWLVCLAIWMAIRTEGTAKF LAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSDAYTLAGIGHNLLWVTLGNTLSGVVF MGLGYWYATPKSERPAPAKINQPEAAANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cct8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15460116 3x 1.0 µg

Cct8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)
MBS6401892-01 0.1 mL

RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)

Sign In for Pricing
View Details
RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)
MBS6401892-02 5x 0.1 mL

RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Rad21 Antibody (CM110-2C10) [Alexa Fluor 647]
NB100-386AF647 0.1 mL

Mouse Monoclonal Rad21 Antibody (CM110-2C10) [Alexa Fluor 647]

Sign In for Pricing
View Details
Mmu-miR-7215-5p inhibitor
HY-RI03968-01 5 nmol

Mmu-miR-7215-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-7215-5p inhibitor
HY-RI03968-02 20 nmol

Mmu-miR-7215-5p inhibitor

Sign In for Pricing
View Details