Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Probable nitrite transporter (nirC)

This Recombinant Salmonella typhimurium Probable nitrite transporter (nirC) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Probable nitrite transporter

UniProt

P25926

Expression Region

1-269

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV MGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTISHGQMWAILPQTWLGNLVGSVFVA LLYSWGGGSLLPVDTSIVHSVALAKTTAPATVLFFKGALCNWLVCLAIWMAIRTEGTAKF LAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSDAYTLAGIGHNLLWVTLGNTLSGVVF MGLGYWYATPKSERPAPAKINQPEAAANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC75 (GPATCH11) (NM_174931) Human Tagged ORF Clone Lentiviral Particle
RC210025L4V 200 µL

CCDC75 (GPATCH11) (NM_174931) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC17A4 Protein Vector (Mouse) (pPB-N-His)
PV229835 500 ng

SLC17A4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
KIBRA Rabbit Polyclonal Antibody (Cy5.5)
orb1011399 100 µL

KIBRA Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Rhomboid protease glpG (glpG), partial
MBS7060293 Inquire

Recombinant Haemophilus influenzae Rhomboid protease glpG (glpG), partial

Sign In for Pricing
View Details
NOD1 Antibody
C45023-01 50 µL

NOD1 Antibody

Sign In for Pricing
View Details
NOD1 Antibody
C45023-02 100 µL

NOD1 Antibody

Sign In for Pricing
View Details