Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Probable nitrite transporter (nirC)

This Recombinant Salmonella typhimurium Probable nitrite transporter (nirC) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Probable nitrite transporter

UniProt

P25926

Expression Region

1-269

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV MGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTISHGQMWAILPQTWLGNLVGSVFVA LLYSWGGGSLLPVDTSIVHSVALAKTTAPATVLFFKGALCNWLVCLAIWMAIRTEGTAKF LAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSDAYTLAGIGHNLLWVTLGNTLSGVVF MGLGYWYATPKSERPAPAKINQPEAAANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Universal Primate Protein Whole Tissue Total Protein Lysate
NHFF-0524-HX575 Each

Universal Primate Protein Whole Tissue Total Protein Lysate

Sign In for Pricing
View Details
Recombinant Human PARK7/ DJ-1 Protein, His-SUMO, E.coli-200ug
QP8031-ec-200ug 200ug

Recombinant Human PARK7/ DJ-1 Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
CRTAC1 Polyclonal Antibody, RBITC Conjugated
bs-12948R-RBITC 100 µL

CRTAC1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Glutathione S Transferase theta 2 Antibody
orb1324182 100 µL

Glutathione S Transferase theta 2 Antibody

Sign In for Pricing
View Details
Factor IX (F9) (NM_000133) Human Recombinant Protein
TP761962 50 µg

Factor IX (F9) (NM_000133) Human Recombinant Protein

Sign In for Pricing
View Details
MTRF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV712534 1.0 µg DNA

MTRF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details