Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas atlantica ATP synthase subunit a (atpB)

This Recombinant Pseudoalteromonas atlantica ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q15MT8

Expression Region

1-270

Origin

Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSAGEQTISGYIQHHLTNASVGEGFWTFHVDTLAWSVVLGLVFILSFRAVAKKASAGV PGKWQACVELIVEFVDDTVKSTYHGKSALIAPLALTIFVWVLLMNLMDLIPVDFLPTAAA LIAGESMDVIAAGQSHTYMKVVPTTDVNMTFALSLGVFALMIFYSVKIKGFGGFMKELYA HPFNTPWLYWFNFILELVSLIAKPLSLSLRLFGNLYAGELIFILIAGTLGVWQLPIHFLW AAFHLLVIPLQAFIFMMLTIVYLSLASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL
BNC742952-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tal1 (BTL73), CF740 conjugate, 0.1mg/mL
BNC742852-500 1x 500 µL

Tal1 (BTL73), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details