Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yarrowia lipolytica Glyoxylate pathway regulator (GPR1)

This Recombinant Yarrowia lipolytica Glyoxylate pathway regulator (GPR1) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Glyoxylate pathway regulator

UniProt

P41943

Expression Region

1-270

Origin

Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTEIPDLEKQQIDHNSGSDDPQPIHDDMAPVSRIRSSGPNHEYIHIADQKFHRDDFYRA FGGTLNPGGAPQPSRKFGNPAPLGLSAFALTTLVFSLCTVQARGVPNPSIAVGLALFYGG VCQFAAGMWEFVQENTFGAAALTSYGGFWMSWAAIEMNAFGIKDSYNDPIEVQNAVGIYL FGWFIFTLMLTLCTLKSTVAFFGLFFMLMMTFLVLACANVTQHHGTAIGGGWLGIITAFF GFYNAYAGLANPGNSYIVPVPLDMPFVKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF647 conjugate, 0.1mg/mL
BNC472145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details