Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Koribacter versatilis Sec-independent protein translocase protein TatC (tatC)

This Recombinant Koribacter versatilis Sec-independent protein translocase protein TatC (tatC) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Sec-independent protein translocase protein TatC

UniProt

Q1IN69

Expression Region

1-271

Origin

Koribacter versatilis (strain Ellin345)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPTIDPAIRARLSQEALKGMSFLEHLEELRRRIIWTFVYIAAGFGVCWWWHEQIYDFM QRPIMKALAANHLDQKLVYLNPTEPFNMYLKMAFIAGLFVASPFVLYQVWLFIAPGLYKR ERRYVLPFMFSTVLLFLGGGVFGYYMVYPNALTFLIGYSHQFSPMITISEYTDLFLTIIL GLGIVFEMPILVFFLALMGIVSAGWMWRNLRYSILVIFVIAAIITPTTDIMNMCVFAAPM ILLYILSIGVAFLVHPKNRRKRREAQEAQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details