Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat PQ-loop repeat-containing protein 1 (Pqlc1)

This Recombinant Rat PQ-loop repeat-containing protein 1 (Pqlc1) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 1

UniProt

Q5M880

Expression Region

1-271

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVA NILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEE LRVPPRRPYLDFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVL TEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMV DLAILGQAYAFAHHPQKPAPHAVHPASAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C2 Rabbit Polyclonal Antibody (FITC)
orb2129283 100 µL

NR2C2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral human PRLHR shRNA (UAS) - Lentiviral human PRLHR shRNA (UAS, RFP) (25)
GTR15077879 1 Vial

Lentiviral human PRLHR shRNA (UAS) - Lentiviral human PRLHR shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
p53 Polyclonal Antibody
MBS9244744-01 0.1 mL

p53 Polyclonal Antibody

Sign In for Pricing
View Details
p53 Polyclonal Antibody
MBS9244744-02 5x 0.1 mL

p53 Polyclonal Antibody

Sign In for Pricing
View Details
4- (Dimethyl-4H-1,2,4-triazol-3-yl) benzoic acid
SDC13556-01 100 mg

4- (Dimethyl-4H-1,2,4-triazol-3-yl) benzoic acid

Sign In for Pricing
View Details
4- (Dimethyl-4H-1,2,4-triazol-3-yl) benzoic acid
SDC13556-02 1 g

4- (Dimethyl-4H-1,2,4-triazol-3-yl) benzoic acid

Sign In for Pricing
View Details