Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphatidate phosphatase PPAPDC1A (PPAPDC1A)

This Recombinant Human Phosphatidate phosphatase PPAPDC1A (PPAPDC1A) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Phosphatidate phosphatase PPAPDC1A, EC= 3.1.3.4, Phosphatidic acid phosphatase type 2 domain-containing protein 1A

UniProt

Q5VZY2

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS LRVPASLKKEERPTADSAPSLPLEGITEGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
TRV-0023235-01 200 µL

Biotin-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
TRV-0023235-02 1 mL

Biotin-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
SIRT3 Rabbit pAb
A21417 20 µL

SIRT3 Rabbit pAb

Sign In for Pricing
View Details
SLC6A8 siRNA (Human)
MBS8224711-01 15 nmol

SLC6A8 siRNA (Human)

Sign In for Pricing
View Details
SLC6A8 siRNA (Human)
MBS8224711-02 30 nmol

SLC6A8 siRNA (Human)

Sign In for Pricing
View Details
SLC6A8 siRNA (Human)
MBS8224711-03 5x 30 nmol

SLC6A8 siRNA (Human)

Sign In for Pricing
View Details