Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphatidate phosphatase PPAPDC1A (PPAPDC1A)

This Recombinant Human Phosphatidate phosphatase PPAPDC1A (PPAPDC1A) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Phosphatidate phosphatase PPAPDC1A, EC= 3.1.3.4, Phosphatidic acid phosphatase type 2 domain-containing protein 1A

UniProt

Q5VZY2

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS LRVPASLKKEERPTADSAPSLPLEGITEGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Interleukin 12 receptor subunit β 2 (IL12RB2) ELISA kit
GTR10409161 96 Well

Guinea Pig Interleukin 12 receptor subunit β 2 (IL12RB2) ELISA kit

Sign In for Pricing
View Details
Ethyl piperazine-2-carboxylate dihydrochloride
OR96385-01 25 g

Ethyl piperazine-2-carboxylate dihydrochloride

Sign In for Pricing
View Details
Ethyl piperazine-2-carboxylate dihydrochloride
OR96385-02 100 g

Ethyl piperazine-2-carboxylate dihydrochloride

Sign In for Pricing
View Details
Polr3f ORF Vector (Mouse) (pORF)
37196014 1.0 µg DNA

Polr3f ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
NPT2c Double Nickase Plasmid (h2)
sc-403699-NIC-2 20 µg

NPT2c Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TCEB1 Protein Vector (Mouse) (pPM-C-His)
PV237013 500 ng

TCEB1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details