Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PQ-loop repeat-containing protein 1 (PQLC1)

This Recombinant Human PQ-loop repeat-containing protein 1 (PQLC1) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 1

UniProt

Q8N2U9

Expression Region

1-271

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVA NILRILFWFGRRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEE VKVAPRRSFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVL TEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLV DLAILGQAYAFARHPQKPAPHAVHPTGTKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Protein traI (traI)
MBS1132245-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traI (traI)
MBS1132245-02 0.02 mg (Yeast)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traI (traI)
MBS1132245-03 0.02 mg (Baculovirus)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traI (traI)
MBS1132245-04 0.1 mg (Yeast)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traI (traI)
MBS1132245-05 0.1 mg (E-Coli)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traI (traI)
MBS1132245-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Protein traI (traI)

Sign In for Pricing
View Details