Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema denticola Flagellar biosynthetic protein fliP (fliP)

This Recombinant Treponema denticola Flagellar biosynthetic protein fliP (fliP) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliP

UniProt

Q9X5A6

Expression Region

1-271

Origin

Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKNLLILVFFGMILFIPVQVFSQSRFPEGTTAGRTDADPNRQAGRIPFIDFSIREPSTN KDVAFSVQLLIFITLISIAPSLLLLMTSFLRLSIVLDFVKRALSLQQVPPTQVLNGIAFF LTLFIMWPTFTQIYNNAYKPMSEGQIGIEEAYREAEKPMRYFMYKQMQKNPTHIRTFMAM SKLPKPDTLADVPTHILIAAFILHELTIAFQIGIFLYLPFIIIDMIVASILMSMGMIMLP PVQISMPFKLILFVMVDGWGLLFGKLFESFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details