Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neosartorya fumigata Protein alcS (alcS)

This Recombinant Neosartorya fumigata Protein alcS (alcS) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Protein alcS

UniProt

B0YBR5

Expression Region

1-272

Origin

Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTEQGLKNHTAKTSPHDETAMASLTTIPTSVTLSAEQFEKLYLSPLTQRQGMLSKQMGN PTPLALGGFVITTTPLSCCLMGWRGATGSGIAFTGPIIFLGGGLLVLTSILEFILGNTFP CVVFGTIGAFWFAFGCTMTPAFNAAAPFSTSATDTVAGLSSPDFLNTYAFLFIWMGVLML IFLACATRTNAVYVAIFTTLTLVFGFLSGAYWRLAVADALVGNRLVVAAGACLFVASMLG FYLLVAQLFDSVGLPVRLPVGDLSRFWDRRAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF594 conjugate, 0.1mg/mL
BNC942375-100 1x 100 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL
BNC741038-100 1x 100 µL

CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL
BNC471629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details