Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7VQW2

Expression Region

1-272

Origin

Blochmannia floridanus

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSTKSVTQKYIEHHLSNLQFDLKNLTLVQSHENMSFWVLNIDSLFFSVLLCLLFLVIAG FVAKYSTVSVPGKLQAFVELIISFVDGCVKDMFHGTSKLISPLSMTVFVWIILMNSMDLI PIDLLPCIADYFFGIPTLRILPSADINITCAMALNIFALMIFYYIKTNGIIGFVSSLIYH PFNYSLCIPINFLLEIISLCSKPVSLSLRLFGNMYSGELIFILIAGFLPWWSQWMLSVPW AIFHILIIILQAFIFMVLTIIYLSESHYEYKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tirandamycin B
582721 5 mg

Tirandamycin B

Sign In for Pricing
View Details
HOMER3 Rabbit pAb, PerCP-Cy7 conjugated
orb2849142 100 µL

HOMER3 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (APC)
MBS6443756-01 0.1 mL

ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (APC)

Sign In for Pricing
View Details
ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (APC)
MBS6443756-02 5x 0.1 mL

ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (APC)

Sign In for Pricing
View Details
Anti-SYT17 Antibody Picoband® APC Conjugated
A11587-1-APC 100 µg/Vial

Anti-SYT17 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Guanosine-3',5'-bisphosphate
orb3169436 100 µL

Guanosine-3',5'-bisphosphate

Sign In for Pricing
View Details