Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7VQW2

Expression Region

1-272

Origin

Blochmannia floridanus

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSTKSVTQKYIEHHLSNLQFDLKNLTLVQSHENMSFWVLNIDSLFFSVLLCLLFLVIAG FVAKYSTVSVPGKLQAFVELIISFVDGCVKDMFHGTSKLISPLSMTVFVWIILMNSMDLI PIDLLPCIADYFFGIPTLRILPSADINITCAMALNIFALMIFYYIKTNGIIGFVSSLIYH PFNYSLCIPINFLLEIISLCSKPVSLSLRLFGNMYSGELIFILIAGFLPWWSQWMLSVPW AIFHILIIILQAFIFMVLTIIYLSESHYEYKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL19 Conjugated Antibody
MBS9454812-01 0.1 mL (Biotin)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details
CCL19 Conjugated Antibody
MBS9454812-02 0.1 mL (AF350)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details
CCL19 Conjugated Antibody
MBS9454812-03 0.1 mL (AF405)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details
CCL19 Conjugated Antibody
MBS9454812-04 0.1 mL (AF488)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details
CCL19 Conjugated Antibody
MBS9454812-05 0.1 mL (AF555)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details
CCL19 Conjugated Antibody
MBS9454812-06 0.1 mL (AF594)

CCL19 Conjugated Antibody

Sign In for Pricing
View Details