Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7VQW2

Expression Region

1-272

Origin

Blochmannia floridanus

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSTKSVTQKYIEHHLSNLQFDLKNLTLVQSHENMSFWVLNIDSLFFSVLLCLLFLVIAG FVAKYSTVSVPGKLQAFVELIISFVDGCVKDMFHGTSKLISPLSMTVFVWIILMNSMDLI PIDLLPCIADYFFGIPTLRILPSADINITCAMALNIFALMIFYYIKTNGIIGFVSSLIYH PFNYSLCIPINFLLEIISLCSKPVSLSLRLFGNMYSGELIFILIAGFLPWWSQWMLSVPW AIFHILIIILQAFIFMVLTIIYLSESHYEYKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GMNC Protein Lysate
MBS8412369-01 0.02 mg

Human GMNC Protein Lysate

Sign In for Pricing
View Details
Human GMNC Protein Lysate
MBS8412369-02 5x 0.02 mg

Human GMNC Protein Lysate

Sign In for Pricing
View Details
NADPH oxidase 4 Rabbit Polyclonal Antibody (Biotin)
orb114286 100 µL

NADPH oxidase 4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
hsa-miR-600 miRNA Antagomir
MBS8316316-01 10 nmol

hsa-miR-600 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-600 miRNA Antagomir
MBS8316316-02 20 nmol

hsa-miR-600 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-600 miRNA Antagomir
MBS8316316-03 5x 20 nmol

hsa-miR-600 miRNA Antagomir

Sign In for Pricing
View Details