Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Uncharacterized protein BH0177 (BH0177)

This Recombinant Bacillus halodurans Uncharacterized protein BH0177 (BH0177) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Uncharacterized protein BH0177

UniProt

Q9KGC7

Expression Region

1-272

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRRSNLELLLQCFYRKKVYLSVFIVLALYCVNLLIENASSEKNVYDLLMQLTEFHPLT YTIIPTYLVVLTAHFSLGKMHHYLAFRCKDKRQWYNLNVSCIAIVTTGYSVLIAFIMLMQ SLFVFRFENKWSTFAVDYYTYHATFLMNYSPLVYSIATLLLLWLLLFLLGLLFYVIFIWT KSPLVSLLFVFLLNIMNAAVTLGKIDTLTPVFFTDRVSIIQYVYKFDLNQDSFPYSIFVY WIMLIAVIYLIGWLVIQRVDFESEKGEKHHAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ARAF Antibody
RC-5600-01 50 μL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
Recombinant ARAF Antibody
RC-5600-02 100 µL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
Recombinant ARAF Antibody
RC-5600-03 1 mL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 5 (GRM5) Human Gene Knockout Kit (CRISPR)
KN416892 1 Kit

Metabotropic Glutamate Receptor 5 (GRM5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B2]
TA505868BM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B2]

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF405S conjugate, 0.1mg/mL
BNC042179-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details