Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Uncharacterized protein BH0177 (BH0177)

This Recombinant Bacillus halodurans Uncharacterized protein BH0177 (BH0177) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Uncharacterized protein BH0177

UniProt

Q9KGC7

Expression Region

1-272

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRRSNLELLLQCFYRKKVYLSVFIVLALYCVNLLIENASSEKNVYDLLMQLTEFHPLT YTIIPTYLVVLTAHFSLGKMHHYLAFRCKDKRQWYNLNVSCIAIVTTGYSVLIAFIMLMQ SLFVFRFENKWSTFAVDYYTYHATFLMNYSPLVYSIATLLLLWLLLFLLGLLFYVIFIWT KSPLVSLLFVFLLNIMNAAVTLGKIDTLTPVFFTDRVSIIQYVYKFDLNQDSFPYSIFVY WIMLIAVIYLIGWLVIQRVDFESEKGEKHHAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XC-DAPOL-CPBA (>90%)
TRC-X742015-50MG 50 mg

XC-DAPOL-CPBA (>90%)

Sign In for Pricing
View Details
Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI1D6]
CF805892 100 µg

Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

Sign In for Pricing
View Details
Trimethyl Lys4 Histone H3 Polyclonal Antibody
A009-25MG 25 mg

Trimethyl Lys4 Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
IL-4 / Interleukin 4 (IL4/1597), CF568 conjugate, 0.1mg/mL
BNC681597-500 1x 500 µL

IL-4 / Interleukin 4 (IL4/1597), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCC Polyclonal Antibody
E-AB-90701-01 60 µL

MCC Polyclonal Antibody

Sign In for Pricing
View Details
MCC Polyclonal Antibody
E-AB-90701-02 120 µL

MCC Polyclonal Antibody

Sign In for Pricing
View Details