Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nickel/cobalt efflux system rcnA (rcnA)

This Recombinant Nickel/cobalt efflux system rcnA (rcnA) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Nickel/cobalt efflux system rcnA

UniProt

A1ACX1

Expression Region

1-274

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFTTLLQQGNAWFFIPSAILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM HEHDHEHHHHDHEDHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSLGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL
BNC041983-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF488A conjugate, 0.1mg/mL
BNC880983-500 1x 500 µL

CD117 (KIT/983), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF405S conjugate, 0.1mg/mL
BNC040712-500 1x 500 µL

MyoD1 (MYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details