Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nickel/cobalt efflux system rcnA (rcnA)

This Recombinant Nickel/cobalt efflux system rcnA (rcnA) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Nickel/cobalt efflux system rcnA

UniProt

Q8FFX9

Expression Region

1-274

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFTTLLQQGNAWFFIPSAILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM HEHDHEHHHHDHEDHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSLGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (OKT3), CF405S conjugate, 0.1mg/mL
BNC040268-100 1x 100 µL

CD3e (T-Cell Marker) (OKT3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF594 conjugate, 0.1mg/mL
BNC940715-500 1x 500 µL

Thymidylate Synthase (TMS715), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF405S conjugate, 0.1mg/mL
BNC040495-500 1x 500 µL

SUMO-1 (SM1/495), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details