Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Nurim (nrm)

This Recombinant Danio rerio Nurim (nrm) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q1L911

Expression Region

1-275

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVTFRDGFLCVSALITFVFVFVTGADFVRFVSFRAINHNLSGAAPLCRDSVPWSVALR DGVVQKAVAVDVLLLVVFSLQHSLLAWTPVKRVCQSVFGVLSRSVYCFTTAAALQILMHY WRPVTSAPCLWSVSSAPWEIWFPLICFIVHFLCWAIICSILLIFDYPELLGIKQVYYECL GLGDPLLLKSERAQRLYSHLRHPVCVELLTVLWLLPSFPLDRLLLAVFLTVYLILAHSLD KQDCAYLRHQLRNKLQLFSTPLEGSEQTNDNNKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B3]
TA803803AM 100 µL

GLI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B3]

Sign In for Pricing
View Details
CD44 Rabbit pAb
MBS8547939-01 0.1 mL

CD44 Rabbit pAb

Sign In for Pricing
View Details
CD44 Rabbit pAb
MBS8547939-02 0.1 mL (AF405L)

CD44 Rabbit pAb

Sign In for Pricing
View Details
CD44 Rabbit pAb
MBS8547939-03 0.1 mL (AF405S)

CD44 Rabbit pAb

Sign In for Pricing
View Details
CD44 Rabbit pAb
MBS8547939-04 0.1 mL (AF610)

CD44 Rabbit pAb

Sign In for Pricing
View Details
CD44 Rabbit pAb
MBS8547939-05 0.1 mL (AF635)

CD44 Rabbit pAb

Sign In for Pricing
View Details