Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Nurim (nrm)

This Recombinant Danio rerio Nurim (nrm) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q1L911

Expression Region

1-275

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVTFRDGFLCVSALITFVFVFVTGADFVRFVSFRAINHNLSGAAPLCRDSVPWSVALR DGVVQKAVAVDVLLLVVFSLQHSLLAWTPVKRVCQSVFGVLSRSVYCFTTAAALQILMHY WRPVTSAPCLWSVSSAPWEIWFPLICFIVHFLCWAIICSILLIFDYPELLGIKQVYYECL GLGDPLLLKSERAQRLYSHLRHPVCVELLTVLWLLPSFPLDRLLLAVFLTVYLILAHSLD KQDCAYLRHQLRNKLQLFSTPLEGSEQTNDNNKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS14 Rabbit Polyclonal Antibody (PE)
orb487107 100 µL

RGS14 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CD74 Rabbit Polyclonal Antibody (APC)
orb1006412 100 µL

CD74 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
MYO9B Rabbit Polyclonal Antibody (PerCP)
orb2472105 100 µL

MYO9B Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Peroxin 6 (F-6) AC
sc-271813 AC 500 µg/mL - 25% ag

Peroxin 6 (F-6) AC

Sign In for Pricing
View Details
Human hsa-miR-3941 miRNA Antagomir
abx886456-01 10 nmol

Human hsa-miR-3941 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-3941 miRNA Antagomir
abx886456-02 20 nmol

Human hsa-miR-3941 miRNA Antagomir

Sign In for Pricing
View Details