Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8FNQ1

Expression Region

1-275

Origin

Corynebacterium efficiens

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKAHVTDGDHGPALTEGVTTALNWLSVLPIRGATTFDRITGARVMASLPVVGVVFGVL TAVLLGLLGVLGVTPLLTAVLVVIMWELLNRMMHLDGLADVADALGSYAAPERAREILAD PHTGLMGFSAVLFSLLVQVTAVAALVEGKAGWLVCFIPALSRLGGQIMARVGRTPLSPTG FGAMVVGTVRLWWVAAWLVALGVTAGGVAVWAAGPAVVWIVPAAGIIACVVSESAGRHVS RRFGGVNGDCIGAGIHLSAAVVAVFCAVAVAGMTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUSK (NM_005592) Human Recombinant Protein
TP700168 20 µg

MUSK (NM_005592) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human MLIP shRNA (UAS) - Lentiviral human MLIP shRNA (UAS) plasmid
GTR15341734 1 Vial

Lentiviral human MLIP shRNA (UAS) - Lentiviral human MLIP shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human IGHE Protein, N-His
YHJ92702 100 μg

Recombinant Human IGHE Protein, N-His

Sign In for Pricing
View Details
ST8SIA4 Rabbit Polyclonal Antibody
orb580484 100 µL

ST8SIA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Micafungin Sodium
C10086-1g 1 g

Micafungin Sodium

Sign In for Pricing
View Details
Rabbit Monoclonal Nicastrin Antibody (002) [DyLight 650]
NBP2-89825C 0.1 mL

Rabbit Monoclonal Nicastrin Antibody (002) [DyLight 650]

Sign In for Pricing
View Details