Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8FNQ1

Expression Region

1-275

Origin

Corynebacterium efficiens

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKAHVTDGDHGPALTEGVTTALNWLSVLPIRGATTFDRITGARVMASLPVVGVVFGVL TAVLLGLLGVLGVTPLLTAVLVVIMWELLNRMMHLDGLADVADALGSYAAPERAREILAD PHTGLMGFSAVLFSLLVQVTAVAALVEGKAGWLVCFIPALSRLGGQIMARVGRTPLSPTG FGAMVVGTVRLWWVAAWLVALGVTAGGVAVWAAGPAVVWIVPAAGIIACVVSESAGRHVS RRFGGVNGDCIGAGIHLSAAVVAVFCAVAVAGMTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus type 11L1-capsids (HPV11L1) ELISA Kit
SL2623Hu-01 48 Tests

Human Papillomavirus type 11L1-capsids (HPV11L1) ELISA Kit

Sign In for Pricing
View Details
Human Papillomavirus type 11L1-capsids (HPV11L1) ELISA Kit
SL2623Hu-02 96 Tests

Human Papillomavirus type 11L1-capsids (HPV11L1) ELISA Kit

Sign In for Pricing
View Details
SAA1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-19359R-BF594 100 µL

SAA1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Human HAUS7 Protein
E30P6867 20 µg

Recombinant Human HAUS7 Protein

Sign In for Pricing
View Details
Recombinant Treponema Pallidum fliH Protein (aa 1-309)
VAng-Cr1156-50gEcoli 50 µg (E. coli)

Recombinant Treponema Pallidum fliH Protein (aa 1-309)

Sign In for Pricing
View Details
LST 3TM12 (SLCO1B7) Human shRNA Plasmid Kit (Locus ID 338821)
TL315181 1 Kit

LST 3TM12 (SLCO1B7) Human shRNA Plasmid Kit (Locus ID 338821)

Sign In for Pricing
View Details