Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF2

This Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF2 spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein ORF2

UniProt

P40980

Expression Region

1-275

Origin

Caldicellulosiruptor sp. (strain Rt8B.4)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKETKKWYFIFLAVWTLIADVPFLFMLFTSFKTQSELLSGNTWQIPRQPTIGNFSTV LEGNFFTYLKNSVIAVSISVVLILIISSMAAFAFSRFKFALNNLLYSLIIAGMAIPIHVT LIPIYVLTNKIKLYDTVFALIGPYVALSLPMSIFILTEFMREIPLELEEAAKIDGCSMFR LYSDILLPLSAPALITVGIYNGTYLWNEFVFALVLTSSPTRRTLPLGIWDFQARYGSDIP AIMAFLTLSLLPMLIAYIFGQDKIIKGMMAGAVKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), CF405S conjugate, 0.1mg/mL
BNC042147-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (KRTH/2147R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF405S conjugate, 0.1mg/mL
BNC041629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details