Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A1AGU7

Expression Region

1-276

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTF1, CT (CTF1, Cardiotrophin-1) (MaxLight 650) discontinued
034328-ML650 100 µL

CTF1, CT (CTF1, Cardiotrophin-1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DHFR Mouse Monoclonal Antibody [Clone 6G7]
E45M09211V-2 50 µL

DHFR Mouse Monoclonal Antibody [Clone 6G7]

Sign In for Pricing
View Details
Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)
373039-01 20 µg

Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)

Sign In for Pricing
View Details
Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)
373039-02 100 µg

Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)

Sign In for Pricing
View Details
Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)
373039-03 1 mg

Dermcidin, Recombinant, Human, aa20-110, GST-Tag (DCD)

Sign In for Pricing
View Details
CHST8 (NM_001127895) Human Tagged Lenti ORF Clone
RC225689L3 10 µg

CHST8 (NM_001127895) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details