Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A1AGU7

Expression Region

1-276

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PXMP2 knockdown cell line
ABC-KD12480 1 Vial

Human PXMP2 knockdown cell line

Sign In for Pricing
View Details
Tmem95 (NM_001134799) Rat Tagged ORF Clone Lentiviral Particle
RR210644L3V 200 µL

Tmem95 (NM_001134799) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Guinea pig Anti-Sperm Antibody (AsAb) ELISA Kit
EIA05327Gu 1 Kit

Guinea pig Anti-Sperm Antibody (AsAb) ELISA Kit

Sign In for Pricing
View Details
Semaphorin 5A (SEMA5A) (NM_003966) Human Over-expression Lysate
LS009037-20ug 20 µg

Semaphorin 5A (SEMA5A) (NM_003966) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA-A*0201 AFP Complex Tetramer, Human (FMNKFIYEI, HEK293, His-Avi)
HY-P77762 1 Each

HLA-A*0201 AFP Complex Tetramer, Human (FMNKFIYEI, HEK293, His-Avi)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-4732-3p miRNA Agomir/Antagomir
AM1460 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-4732-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details