Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A1AGU7

Expression Region

1-276

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat soluble fibrinmonomer complex (SFMC) ELISA Kit
NSL0172Gt 96 Tests

Goat soluble fibrinmonomer complex (SFMC) ELISA Kit

Sign In for Pricing
View Details
4- (1,3-Dioxolan-2-yl) -N'-hydroxy-benzenecarboximidamide
sc-313868 500 mg

4- (1,3-Dioxolan-2-yl) -N'-hydroxy-benzenecarboximidamide

Sign In for Pricing
View Details
Git1 3'UTR Lenti-reporter-Luc Vector
21529086 1.0 µg

Git1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CCDC93 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]
TA800598AM 100 µL

CCDC93 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
ELISA Kit For High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
E12007m 96 Tests

ELISA Kit For High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

Sign In for Pricing
View Details
Anti-METAP2 Antibody Picoband® Fluoro647 Conjugated
A03648-2-Fluoro647 100 µg/Vial

Anti-METAP2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details