Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Pseudomonas stutzeri Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

A4VLM0

Expression Region

1-276

Origin

Pseudomonas stutzeri (strain A1501)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLWVAIQALILGVVEGITEFLPVSSTGHQIIVADLIGFGGERALAFNIIIQLGAILAVI WEYRRKIIDVVVGLPEERQAQKFTVNLLIAFMPAVVLGVAFADLIHEYLFNPITVAAALV IGGIVMLWAERRDHAIRAETVDDMTWTLALKVGFAQCLALVPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDFAVFAIGFVTSFIFAMLAVRALLKF IGNHSYAAFAWYRIGFGLLILATWQLGMIDWSTAIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details