Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Undecaprenyl-diphosphatase (uppP)

This Recombinant Pseudomonas putida Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A5W499

Expression Region

1-276

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFWTAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAMAFNIIIQLAAILAVV WEFRSKIFEVVFGLTHQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFNPVTVAAALV VGGVIMLWAERRKHRVEVDHVDDMRWSHALKIGFIQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDLPVFALGFVTSFIFAMIAVRALLKF IANHSYAAFAWYRIVFGLFILATWQFGWVDWSTAHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC/1059), CF740 conjugate, 0.1mg/mL
BNC741059-500 1x 500 µL

CD71 (TFRC/1059), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562300 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
TFAM Antibody
KC-3258-01 50 μL

TFAM Antibody

Sign In for Pricing
View Details
TFAM Antibody
KC-3258-02 100 µL

TFAM Antibody

Sign In for Pricing
View Details
TFAM Antibody
KC-3258-03 1 mL

TFAM Antibody

Sign In for Pricing
View Details
ViaFluor® 405 Live Cell Microtubule Stain
#70064-T 1 Kit

ViaFluor® 405 Live Cell Microtubule Stain

Sign In for Pricing
View Details