Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Undecaprenyl-diphosphatase (uppP)

This Recombinant Pseudomonas putida Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A5W499

Expression Region

1-276

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFWTAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAMAFNIIIQLAAILAVV WEFRSKIFEVVFGLTHQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFNPVTVAAALV VGGVIMLWAERRKHRVEVDHVDDMRWSHALKIGFIQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDLPVFALGFVTSFIFAMIAVRALLKF IANHSYAAFAWYRIVFGLFILATWQFGWVDWSTAHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human CNGA3 (Cyclic nucleotide gated channel subunit alpha 3) Full Length
MPC1053K Each

Magic™ Membrane Protein Human CNGA3 (Cyclic nucleotide gated channel subunit alpha 3) Full Length

Sign In for Pricing
View Details
G6PC3 Polyclonal Antibody, Cy5 Conjugated
bs-13253R-Cy5 100 µL

G6PC3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Olfr538 AAV Vector (Mouse) (CMV)
33238104 1 µg

Olfr538 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Phospho-KLF5 (Ser311) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2303R-BF594 100 µL

Phospho-KLF5 (Ser311) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
SERPINA10 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb879246 100 µL

SERPINA10 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Rat Beta-glucuronidase ELISA Kit
MBS288925-01 48 Well

Rat Beta-glucuronidase ELISA Kit

Sign In for Pricing
View Details