Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Rhomboid protease glpG (glpG)

This Recombinant Citrobacter koseri Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A8AQX4

Expression Region

1-276

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHHQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQSGHTGSGLHYRRFPFIATLRERAGPVTWLIMIACILVFVVMSIVGAQSVM VWLAWPFDPSLKFEFWRYFTHAFMHFSLMHILFNLLWWWYIGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYAWLRGERDPQSGIYLQRGLIAFALIWIVAG WFDVFGMSMANGAHIAGLAVGLAMAFADTVNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-DPY30 Polyclonal Antibody
PAV6753 100 μL

Rabbit Anti-DPY30 Polyclonal Antibody

Sign In for Pricing
View Details
Integrin alpha 2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-52613R-BF680-01 20 µL

Integrin alpha 2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Integrin alpha 2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-52613R-BF680-02 100 µL

Integrin alpha 2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
GGT1 (Gamma-glutamyltranspeptidase 1, GGT 1, GGT, CD224, D22S672, D22S732, Gamma-glutamyltransferase 1, GTG, MGC96892, MGC96904, MGC96963)
127287 50 µg

GGT1 (Gamma-glutamyltranspeptidase 1, GGT 1, GGT, CD224, D22S672, D22S732, Gamma-glutamyltransferase 1, GTG, MGC96892, MGC96904, MGC96963)

Sign In for Pricing
View Details
ANKEF1 siRNA (Mouse)
orb1835005-01 15 nmol

ANKEF1 siRNA (Mouse)

Sign In for Pricing
View Details
ANKEF1 siRNA (Mouse)
orb1835005-02 30 nmol

ANKEF1 siRNA (Mouse)

Sign In for Pricing
View Details