Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Rhomboid protease glpG (glpG)

This Recombinant Citrobacter koseri Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A8AQX4

Expression Region

1-276

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHHQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQSGHTGSGLHYRRFPFIATLRERAGPVTWLIMIACILVFVVMSIVGAQSVM VWLAWPFDPSLKFEFWRYFTHAFMHFSLMHILFNLLWWWYIGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYAWLRGERDPQSGIYLQRGLIAFALIWIVAG WFDVFGMSMANGAHIAGLAVGLAMAFADTVNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Litaf Pre-designed siRNA Set A
SI107591A 1 Each

Mouse Litaf Pre-designed siRNA Set A

Sign In for Pricing
View Details
Otx2 sgRNA CRISPR Lentivector set (Rat)
K6348401 3x 1.0 µg

Otx2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
OAEC00543-50UG - Raf1 (Ab-338) Antibody
OAEC00543-50UG 50 µg

OAEC00543-50UG - Raf1 (Ab-338) Antibody

Sign In for Pricing
View Details
Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit
MBS2154865-01 96 Tests

Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit
MBS2154865-02 5x 96 Tests

Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit
MBS2154865-03 10x 96 Tests

Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details