Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Rhomboid protease glpG (glpG)

This Recombinant Salmonella enteritidis PT4 Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

B5R383

Expression Region

1-276

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silwet® L-77
30630216-2 25 mL

Silwet® L-77

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 2 (P3H2) Antibody
abx317977-01 20 µg

Prolyl 3-Hydroxylase 2 (P3H2) Antibody

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 2 (P3H2) Antibody
abx317977-02 50 µg

Prolyl 3-Hydroxylase 2 (P3H2) Antibody

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 2 (P3H2) Antibody
abx317977-03 100 µg

Prolyl 3-Hydroxylase 2 (P3H2) Antibody

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 2 (P3H2) Antibody
abx317977-04 200 µg

Prolyl 3-Hydroxylase 2 (P3H2) Antibody

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 2 (P3H2) Antibody
abx317977-05 1 mg

Prolyl 3-Hydroxylase 2 (P3H2) Antibody

Sign In for Pricing
View Details