Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Rhomboid protease glpG (glpG)

This Recombinant Salmonella enteritidis PT4 Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

B5R383

Expression Region

1-276

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBCK1, NT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Prot
MBS6497112-01 0.1 mL

RBCK1, NT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Prot

Sign In for Pricing
View Details
RBCK1, NT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Prot
MBS6497112-02 5x 0.1 mL

RBCK1, NT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Prot

Sign In for Pricing
View Details
Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [DyLight 488]
NBP2-98008G 0.1 mL

Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [DyLight 488]

Sign In for Pricing
View Details
Rat Cytochrome P450 11B1 (CYP11B1) ELISA Kit
RDR-CYP11B1-Ra-01 96 Tests

Rat Cytochrome P450 11B1 (CYP11B1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 11B1 (CYP11B1) ELISA Kit
RDR-CYP11B1-Ra-02 48 Tests

Rat Cytochrome P450 11B1 (CYP11B1) ELISA Kit

Sign In for Pricing
View Details
IL17F Rabbit anti-Human Polyclonal (aa31-163) Antibody
MBS2402973-01 0.05 mL

IL17F Rabbit anti-Human Polyclonal (aa31-163) Antibody

Sign In for Pricing
View Details