Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1036 (PH1036)

This Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1036 (PH1036) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Probable ABC transporter permease protein PH1036

UniProt

O58760

Expression Region

1-276

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIRRYLVPNLIAWSIGIAWLIPFMGVLMASVRPYEEIVSGWWHLHPFTITLKNYINALN HPMFPIGEGLKNSLIVAIPSTIVPVIVASLAAYAFARYSFPIKHYLFAFIVLLMALPQQM TVVPLYFLLRNAHLLNTFRGLIIVHSAWGLAWIIFFMRNYFSMLPTDVEEAAKIDGATDF QIFYKIVLPMALPGLISASILQFTWVWSDFFLALVFLQNPEKYVATQRLPLLRGQYFVDW GLLTAASIMVMLVPLLVYALFQKYYISGMIGWSVEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maltosine
TRC-M161500-250MG 250 mg

Maltosine

Sign In for Pricing
View Details
Mouse Chic1 activation kit by CRISPRa
GA200443 1 Kit

Mouse Chic1 activation kit by CRISPRa

Sign In for Pricing
View Details
ACAT1 Human Gene Knockout Kit (CRISPR)
KN417753 1 Kit

ACAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RIP3 Polyclonal Antibody
E-AB-60962-01 60 µL

RIP3 Polyclonal Antibody

Sign In for Pricing
View Details
RIP3 Polyclonal Antibody
E-AB-60962-02 120 µL

RIP3 Polyclonal Antibody

Sign In for Pricing
View Details
RIP3 Polyclonal Antibody
E-AB-60962-03 200 µL

RIP3 Polyclonal Antibody

Sign In for Pricing
View Details