Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 56 (Tmem56)

This Recombinant Mouse Transmembrane protein 56 (Tmem56) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 56

UniProt

Q8CGF5

Expression Region

1-276

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASTKAAVGSGAMEASTKAVICTVCSSFVVFQILFHFVSYWFSARVSSGYNSLSIDKKI EWNSRVVSTCHSLLVGIFGLYLFFFDEATITDPLWGDPTYVNINIATASGYLISDLLIIL FNWKVIGDKFFIIHHCAGLTAYYFVLTTGALAYIANFRLLAELSSPFVNQRWFFEALKYP KFSKANVINGILMTVVFFIVRIISIPPMYFFLYSVYGTEPYIRFGFVIQSVWIVTCVILD VMNIMWMIKITKGCIKVISLIRQEKAKDSLQNGKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD168 (HMMR) (NM_012484) Human Tagged Lenti ORF Clone
RC213321L3 10 µg

CD168 (HMMR) (NM_012484) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (MaxLight 550) discontinued
044077-ML550 100 µL

ZFYVE1, NT (ZFYVE1, DFCP1, KIAA1589, TAFF1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1, Double FYVE-containing protein 1, SR3, Tandem FYVE fingers-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-p130 Cas Antibody
CPA6079-01 30 µL

Anti-p130 Cas Antibody

Sign In for Pricing
View Details
Anti-p130 Cas Antibody
CPA6079-02 50 μL

Anti-p130 Cas Antibody

Sign In for Pricing
View Details
Anti-p130 Cas Antibody
CPA6079-03 100 µL

Anti-p130 Cas Antibody

Sign In for Pricing
View Details
Anti-p130 Cas Antibody
CPA6079-04 200 µL

Anti-p130 Cas Antibody

Sign In for Pricing
View Details