Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 56 (Tmem56)

This Recombinant Mouse Transmembrane protein 56 (Tmem56) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 56

UniProt

Q8CGF5

Expression Region

1-276

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASTKAAVGSGAMEASTKAVICTVCSSFVVFQILFHFVSYWFSARVSSGYNSLSIDKKI EWNSRVVSTCHSLLVGIFGLYLFFFDEATITDPLWGDPTYVNINIATASGYLISDLLIIL FNWKVIGDKFFIIHHCAGLTAYYFVLTTGALAYIANFRLLAELSSPFVNQRWFFEALKYP KFSKANVINGILMTVVFFIVRIISIPPMYFFLYSVYGTEPYIRFGFVIQSVWIVTCVILD VMNIMWMIKITKGCIKVISLIRQEKAKDSLQNGKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Contactin 1 (CNTN1) ELISA kit
YLA3005HU-01 48 Tests

Human Contactin 1 (CNTN1) ELISA kit

Sign In for Pricing
View Details
Human Contactin 1 (CNTN1) ELISA kit
YLA3005HU-02 96 Tests

Human Contactin 1 (CNTN1) ELISA kit

Sign In for Pricing
View Details
Nori® Rabbit Ephrin B2 ELISA Kit
GR144258 96 Well

Nori® Rabbit Ephrin B2 ELISA Kit

Sign In for Pricing
View Details
EMP3 Protein Lysate
OCOA00492-20UG 20 µg

EMP3 Protein Lysate

Sign In for Pricing
View Details
PRSS12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV645992 1.0 µg DNA

PRSS12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
5' LC®Red610 / 3' BHQ-2®
FP-131-50 50 to 70 nmol

5' LC®Red610 / 3' BHQ-2®

Sign In for Pricing
View Details