Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 56 (Tmem56)

This Recombinant Mouse Transmembrane protein 56 (Tmem56) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 56

UniProt

Q8CGF5

Expression Region

1-276

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEASTKAAVGSGAMEASTKAVICTVCSSFVVFQILFHFVSYWFSARVSSGYNSLSIDKKI EWNSRVVSTCHSLLVGIFGLYLFFFDEATITDPLWGDPTYVNINIATASGYLISDLLIIL FNWKVIGDKFFIIHHCAGLTAYYFVLTTGALAYIANFRLLAELSSPFVNQRWFFEALKYP KFSKANVINGILMTVVFFIVRIISIPPMYFFLYSVYGTEPYIRFGFVIQSVWIVTCVILD VMNIMWMIKITKGCIKVISLIRQEKAKDSLQNGKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria Gonorrhoeae rsgA Protein (aa 1-307) (strain NCCP11945)
VAng-Wyb2392-1mgEcoli 1 mg (E. coli)

Recombinant Neisseria Gonorrhoeae rsgA Protein (aa 1-307) (strain NCCP11945)

Sign In for Pricing
View Details
Rabbit Anti-HEXB chain A antibody
SL10463R-01 50 µL

Rabbit Anti-HEXB chain A antibody

Sign In for Pricing
View Details
Rabbit Anti-HEXB chain A antibody
SL10463R-02 100 µL

Rabbit Anti-HEXB chain A antibody

Sign In for Pricing
View Details
MTRF1 Mouse Monoclonal Antibody [Clone 6D2]
E45M21014V-2 50 µL

MTRF1 Mouse Monoclonal Antibody [Clone 6D2]

Sign In for Pricing
View Details
ACAD-8 (D-5) Alexa Fluor® 647
sc-390038 AF647 200 µg/mL

ACAD-8 (D-5) Alexa Fluor® 647

Sign In for Pricing
View Details
PE Anti-Mouse CD49b Antibody
MBS4515041-01 0.025 mg

PE Anti-Mouse CD49b Antibody

Sign In for Pricing
View Details