Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Rhomboid protease glpG (glpG)

This Recombinant Shigella flexneri serotype 5b Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q0SZP2

Expression Region

1-276

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWLAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO2 Antibody
orb1334862 100 µg

NQO2 Antibody

Sign In for Pricing
View Details
Alpha-2C adrenergic receptor Antibody
E55A14586 100 µg

Alpha-2C adrenergic receptor Antibody

Sign In for Pricing
View Details
LOC100365300 3'UTR Luciferase Stable Cell Line
TU209468 1.0 mL

LOC100365300 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial
MBS1134229-01 1 mg (E-Coli)

Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial

Sign In for Pricing
View Details
Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial
MBS1134229-02 1 mg (Yeast)

Recombinant Ajellomyces capsulata Vacuolar protein sorting/targeting protein 10 (VPS10), partial

Sign In for Pricing
View Details
InVivoMAb Anti-Nipah virus/NiV Prefusion Protein Antibody (2B12)
VK521050-01 50 µg

InVivoMAb Anti-Nipah virus/NiV Prefusion Protein Antibody (2B12)

Sign In for Pricing
View Details