Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Rhomboid protease glpG (glpG)

This Recombinant Salmonella paratyphi A Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q5PLZ8

Expression Region

1-276

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVVVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAS WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TCF19 Antibody
NBP3-17794-100ul 100 µL

Rabbit Polyclonal TCF19 Antibody

Sign In for Pricing
View Details
At2g04570 Antibody
orb789317 2 mg

At2g04570 Antibody

Sign In for Pricing
View Details
MAGEE1 Protein Vector (Rat) (pPB-C-His)
PV280770 500 ng

MAGEE1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human PKHG6 (His)
BP4131-500ug 500 µg

Recombinant Human PKHG6 (His)

Sign In for Pricing
View Details
CD11c (CD11 antigen-like family member C, Complement component 3 receptor 4 subunit, Integrin alpha-X, integrin, alpha X (antigen CD11C (p150), alpha polypeptide), Leu M5 alpha subunit, Leukocyte adhesion glycoprotein p150 95 alpha chain, Myeloid membrane antigen alpha subunit, p150/95) (Biotin)
168665-AF-Biotin 100 µL

CD11c (CD11 antigen-like family member C, Complement component 3 receptor 4 subunit, Integrin alpha-X, integrin, alpha X (antigen CD11C (p150), alpha polypeptide), Leu M5 alpha subunit, Leukocyte adhesion glycoprotein p150 95 alpha chain, Myeloid membrane antigen alpha subunit, p150/95) (Biotin)

Sign In for Pricing
View Details
TBPL1 Protein Vector (Human) (pPB-C-His)
PV041437 500 ng

TBPL1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details