Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Rhomboid protease glpG (glpG)

This Recombinant Salmonella paratyphi A Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q5PLZ8

Expression Region

1-276

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVVVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAS WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM219 (NM_194280) Human Tagged ORF Clone
RC207974 10 µg

TMEM219 (NM_194280) Human Tagged ORF Clone

Sign In for Pricing
View Details
[Phe7] Dynorphin A (1-7), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Phe; MW 8590]
SP-88390-5 5 mg

[Phe7] Dynorphin A (1-7), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Phe; MW 8590]

Sign In for Pricing
View Details
Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit
MBS2706872-01 24 Strip Well

Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit
MBS2706872-02 48 Well

Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit
MBS2706872-03 96 Well

Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit
MBS2706872-04 5x 96 Well

Human Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2 (KCNN2) ELISA Kit

Sign In for Pricing
View Details