Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia carotovora subsp. atroseptica Rhomboid protease glpG (glpG)

This Recombinant Erwinia carotovora subsp. atroseptica Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q6CZL3

Expression Region

1-276

Origin

Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRVIALSNPRLAQAFVDYMRTQQVHLDMRPQGHEAELWLEDETQLSKVQEALEIFLRDP TNPRYLAASWQTGSMDTGIQYQRYSYLQTLKQKAGPLTLSVMVVTIAVFILMQISGYESV MTWLAFPAEGQQLQLWRWFSHALLHFSLLHILFNLMWWWYLGGPVEKVLGTGKLLVIALV SALVSGWAQSWCSGTYFGGLSGVVYALMGYVWLRGEREPDGYLSMPRSLMAFALLWLVAG YFDILGMSIANAAHVAGLIVGLLMAFWDTYNKTNPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF568 conjugate, 0.1mg/mL
BNC681571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (ICO-30), CF405S conjugate, 0.1mg/mL
BNC040364-100 1x 100 µL

Human IgM Immunoglobulin (ICO-30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL
BNC882012-100 1x 100 µL

CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details